Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Scooby Campers - Hire or rent a lovingly refurbished vintage VW Campervan | Search engines recommend title length of around 50-60 characters. The length of this title is 73. |
Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
Keywords | VW, Rental, Campervan, classic, Volkswagen, holidays in Scotland, retro, classic, kombi, campers, hire, camping, explore, adventure, highlands, scottish, relaxing, relaxation, chill, cycling, cycle, comfort, scenery, experience, visit | We did not expect meta keywords to be used. It's a worrying sign more than anything, really, as websites with meta keywords often tend to be spammy. |
Load time | 0.6027 seconds on average | Website load speed is pretty fast. |
Alexa global | 18 315 533, as last updated | According to Alexa, the website's popularity is not exactly high. Take this rank with a healthy pinch of salt. |
Total links on homepage | We found 15 links | This is a normal amount of links. |
Number of backlinks | Around 10 | Backlinks is one of the key metrics for search engines. This website seems to have a very low number of backlinks, which means poorer rank in search results. |
Page HTML size | 10.7KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 213.129.84.44. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
Parameter name | Status | Comment |
---|---|---|
Related websites | classic-camper-holidays.co.uk vintagevwcampers.com morayfirthcamperandcaravanhire.co.uk sunnysideclassicvwcamperrentals.co.uk kombicampers.co.uk |
These are the websites that fall into the same category as scoobycampers.com, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
With over 4 million websites indexed (which can seem as a lot, or very little, depending on your point of view), Alexa is perhaps the oldest and certainly the best known ranking system, deservedly or not. The Alexa Global and Local ranks of a website are based on an approximate amount of visitors a given website receives. The more visitors, the higher the rank. The Alexa rank, be it Local or Global, should be taken with a pinch of salt. After all, visitor count is by far not the simple measure of a website's success it's made out to be. For example, a gardening website is never going to be as popular as a movie review website. It does not mean it's not popular within it's niche.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Date: Sun, 22 Oct 2017 08:24:40 GMT Server: Apache X-Powered-By: PHP/5.3.29 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: PHPSESSID=9j3j4cgb4gsgsb65fs8oac8vs7; path=/ Content-Length: 10753 Content-Type: text/html |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1757 mistypes, associated with scoobycampers.com:
If you are curious about what TLD extensions could also match the domain name of scoobycampers.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: