Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Car Accident | Personal Injury | Lawyer Springfield MA - Pava Law Offices | Search engines recommend title length of around 50-60 characters. The length of this title is 73. |
Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
Keywords | Car Accident Lawyer Springfield MA, Personal Injury Lawyer MA, premises liability lawyer Springfield MA | We did not expect meta keywords to be used. It's a worrying sign more than anything, really, as websites with meta keywords often tend to be spammy. |
Load time | 1.0432 seconds on average | Website load speed is pretty fast. |
Alexa global | 16 587 202, as last updated | According to Alexa, the website's popularity is not exactly high. Take this rank with a healthy pinch of salt. |
Total links on homepage | We found 50 links | This is a normal amount of links. |
Number of backlinks | Around 292 | Such a decent amount of backlinks certainly ads to the ranking. |
Page HTML size | 16.1KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 104.219.248.95. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
Domain overview | Registered on 2007-08-22 00:00:00 | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. At this time, domain pavalaw.com is registered at NameSilo, LLC |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
Parameter name | Status | Comment |
---|---|---|
Related websites | springfieldmacaraccidentlawyer.com rachmiellaw.com antonucci-law.com bucklinbradford.com endicottlawfirm.com |
These are the websites that fall into the same category as pavalaw.com, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
With over 4 million websites indexed (which can seem as a lot, or very little, depending on your point of view), Alexa is perhaps the oldest and certainly the best known ranking system, deservedly or not. The Alexa Global and Local ranks of a website are based on an approximate amount of visitors a given website receives. The more visitors, the higher the rank. The Alexa rank, be it Local or Global, should be taken with a pinch of salt. After all, visitor count is by far not the simple measure of a website's success it's made out to be. For example, a gardening website is never going to be as popular as a movie review website. It does not mean it's not popular within it's niche.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Date: Wed, 27 Jul 2016 13:01:59 GMT Server: Apache X-Powered-By: PHP/5.4.35 P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" Expires: Mon, 1 Jan 2001 00:00:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: 056d21d52805fd171ccf0d2793948dd4=2249af7ad1d554fb474af11c1d1ca23e; path=/; HttpOnly Last-Modified: Wed, 27 Jul 2016 13:02:00 GMT Content-Length: 18025 Content-Type: text/html; charset=utf-8 |
WHOIS information |
---|
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. Domain Name: PAVALAW.COM Registrar: NAMESILO, LLC Sponsoring Registrar IANA ID: 1479 Whois Server: whois.namesilo.com Referral URL: http://www.namesilo.com Name Server: DNS1.NAMECHEAPHOSTING.COM Name Server: DNS2.NAMECHEAPHOSTING.COM Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Updated Date: 19-sep-2015 Creation Date: 22-aug-2007 Expiration Date: 22-aug-2016 >>> Last update of whois database: Wed, 27 Jul 2016 13:01:57 GMT <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars. |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1764 mistypes, associated with pavalaw.com:
If you are curious about what TLD extensions could also match the domain name of pavalaw.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: