Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | One Copypasta a Day – Could have been a tagline, but FCC is playin' | Search engines recommend title length of around 50-60 characters. The length of this title is 67. |
Meta description | Could have been a tagline, but FCC is playin' | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 45 characters. |
Load time | 0.5085 seconds on average | Website load speed is pretty fast. |
Total links on homepage | We found 82 links | This is a normal amount of links. |
Page HTML size | 86KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 192.0.78.12. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Server: nginx Date: Tue, 23 Jan 2018 14:30:25 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: <https://wp.me/97Suf>; rel=shortlink X-ac: 1.fra _dfw Strict-Transport-Security: max-age=15552000 |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 2118 mistypes, associated with onestolencopypastaadaykeepsthememesaway.wordpress.com:
If you are curious about what TLD extensions could also match the domain name of onestolencopypastaadaykeepsthememesaway.wordpress.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: