Here is an overview of what we consider to be the key website statistics and information:
| Parameter name | Status | Comment |
|---|---|---|
| Website meta title | The Official Ricky Gervais Merchandise | Search engines recommend title length of around 50-60 characters. The length of this title is 38. |
| Keywords | lol,ricky gervais,guitar,food,Ricky gervais | We did not expect meta keywords to be used. It's a worrying sign more than anything, really, as websites with meta keywords often tend to be spammy. |
| Load time | 1.3736 seconds on average | Website load speed is pretty fast. |
| Total links on homepage | We found 205 links | This is a normal amount of links. |
| Page HTML size | 179KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
| Website server | Server appears to be online. The IP address for the server is 66.6.32.21. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
| Header in detail |
|---|
HTTP/1.1 200 OK Server: openresty Date: Sat, 11 Nov 2017 14:00:14 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding P3P: CP="Tumblr's privacy policy is available here: https://www.tumblr.com/policy/en/privacy" X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff Strict-Transport-Security: max-age=15552001 X-Tumblr-User: officialrickygervaismerchandise X-Tumblr-Pixel-0: https://px.srvcs.tumblr.com/impixu?T=1510408814&J=eyJ0eXBlIjoidXJsIiwidXJsIjoiaHR0cDpcL1wvb2ZmaWNpYWxyaWNreWdlcnZhaXNtZXJjaGFuZGlzZS50dW1ibHIuY29tXC8iLCJyZXF0eXBlIjowLCJyb3V0ZSI6IlwvIn0=&U=KCGMOJOMCF&K=0f2f2647259af57c33a83506e939ad99c000866841a9a0d5cc5be27e76bb27c2--https://px.srvcs.tumblr.com/impixu?T=1510408814&J=eyJ0eXBlIjoicG9zdCIsInVybCI6Imh0dHA6XC9cL29mZmljaWFscmlja3lnZXJ2YWlzbWVyY2hhbmRpc2UudHVtYmxyLmNvbVwvIiwicmVxdHlwZSI6MCwicm91dGUiOiJcLyIsInBvc3RzIjpbeyJwb3N0aWQiOiI3ODc1NTE0 X-Tumblr-Pixel-1: OTM2MiIsImJsb2dpZCI6IjE3MjcxMDI1NCIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiNzgwOTYxODQzODgiLCJibG9naWQiOiIxNzI3MTAyNTQiLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6Ijc3OTk3NTY1MDU3IiwiYmxvZ2lkIjoiMTcyNzEwMjU0Iiwic291cmNlIjozM30seyJwb3N0aWQiOiI3NzkxMjY4Mjg5OSIsImJsb2dpZCI6IjE3MjcxMDI1NCIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiNzc3OTg0OTI2NjIiLCJibG9naWQiOiIxNzI3MTAyNTQiLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6Ijc3NjkwNjMwMjM4IiwiYmxvZ2lkIjoiMTcyNzEwMjU0Iiwic291cmNlIjozM30seyJwb3N0aWQiOiI3NzY5MDM2MDUyMCIsImJsb2dpZCI6IjE3Mj X-Tumblr-Pixel-2: cxMDI1NCIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiNzc1ODE0MjM5OTkiLCJibG9naWQiOiIxNzI3MTAyNTQiLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6Ijc3NTA5NTAyMDc3IiwiYmxvZ2lkIjoiMTcyNzEwMjU0Iiwic291cmNlIjozM30seyJwb3N0aWQiOiI3NzUwOTQ1NzIwNiIsImJsb2dpZCI6IjE3MjcxMDI1NCIsInNvdXJjZSI6MzN9LHsicG9zdGlkIjoiNzc1MDkzODE1NzIiLCJibG9naWQiOiIxNzI3MTAyNTQiLCJzb3VyY2UiOjMzfSx7InBvc3RpZCI6Ijc3NTA5Mjc5MDc1IiwiYmxvZ2lkIjoiMTcyNzEwMjU0Iiwic291cmNlIjozM30seyJwb3N0aWQiOiI3NzUwOTExNTM4MCIsImJsb2dpZCI6IjE3MjcxMDI1NCIsInNvdXJjZSI6MzN9 X-Tumblr-Pixel-3: XX0=&U=KPKCAAFMOM&K=972da8ee4f5031509bcf9294b03527aa36c11e8aecd604389d239f36e7d16c29 X-Tumblr-Pixel: 4 Link: <https://78.media.tumblr.com/avatar_16b0884e7d50_128.png>; rel=icon X-UA-Compatible: IE=Edge,chrome=1 X-UA-Device: desktop Vary: X-UA-Device, Accept, Accept-Encoding |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1929 mistypes, associated with officialrickygervaismerchandise.tumblr.com:
If you are curious about what TLD extensions could also match the domain name of officialrickygervaismerchandise.tumblr.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: