Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | VIP Meet & Assist in M. East & N. African airports | Search engines recommend title length of around 50-60 characters. The length of this title is 50. |
Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
Keywords | Dubai, Abu Dhabi, Qatar-Doha, Oman-Musca, Bahrain-Manama, Kuwait, Tel Aviv, Cairo, SharmElSheikh, Amman, Ankara, Istanbul, Casablanca, Marrakesh, fast, track, meet, assist, greet, premium, lane, airport, assistance, VIP | We did not expect meta keywords to be used. It's a worrying sign more than anything, really, as websites with meta keywords often tend to be spammy. |
Load time | 0.7365 seconds on average | Website load speed is pretty fast. |
Total links on homepage | We found 55 links | This is a normal amount of links. |
Number of backlinks | Around 3 | Backlinks is one of the key metrics for search engines. This website seems to have a very low number of backlinks, which means poorer rank in search results. |
Page HTML size | 38.6KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 178.63.203.16. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Server: nginx Date: Thu, 23 Nov 2017 08:05:34 GMT Content-Type: text/html Content-Length: 39465 Last-Modified: Fri, 17 Nov 2017 04:32:04 GMT Connection: keep-alive ETag: "5a0e6644-9a29" X-Powered-By: PleskLin Accept-Ranges: bytes |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1707 mistypes, associated with middleeastvipfasttrackservice.com:
If you are curious about what TLD extensions could also match the domain name of middleeastvipfasttrackservice.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: