Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Philadelphia Criminal Defense Lawyer Mark D Hauser | Search engines recommend title length of around 50-60 characters. The length of this title is 50. |
Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
Load time | 2.5738 seconds on average | Load speed is a concern and should be improved if and when possible. |
Total links on homepage | We found 66 links | This is a normal amount of links. |
Number of backlinks | Around 5 | Backlinks is one of the key metrics for search engines. This website seems to have a very low number of backlinks, which means poorer rank in search results. |
Page HTML size | 55.8KB | How do we put this... improvement is quite necessary. Load speed is a very important factor in so many ways! |
Website server | Server appears to be online. The IP address for the server is 161.47.17.101. | We are happy to say that the hosting service is provided by a respected company. Physically, the server is located in Milan, Michigan, United States. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
Parameter name | Status | Comment |
---|---|---|
Related websites | phillytrafficlawyer.com philadelphiacriminaldefenselawyerblog.com spadelaw.com phillyticketlawyer.com douglaspearl.com |
These are the websites that fall into the same category as markdhauser.com, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 301 Moved Permanently Server: nginx Content-Type: text/html Date: Fri, 17 Jun 2016 13:21:29 GMT Keep-Alive: timeout=20 Location: http://www.markdhauser.com/ Connection: keep-alive Set-Cookie: X-Mapping-fjhppofk=4D9C4096DE3B2E74FBEC7F51B8599593; path=/ Content-Length: 178 HTTP/1.1 301 Moved Permanently Server: nginx Content-Type: text/html Date: Fri, 17 Jun 2016 13:21:29 GMT Keep-Alive: timeout=20 Location: https://www.markdhauser.com/ X-Type: default Connection: keep-alive Set-Cookie: X-Mapping-fjhppofk=4D9C4096DE3B2E74FBEC7F51B8599593; path=/ Content-Length: 178 HTTP/1.1 200 OK Server: nginx Vary: Accept-Encoding,Cookie X-Cacheable: SHORT Cache-Control: max-age=600, must-revalidate X-Cache: MISS Content-Type: text/html; charset=UTF-8 X-Cache-Group: normal Date: Fri, 17 Jun 2016 13:21:30 GMT Keep-Alive: timeout=20 Link: <https://www.markdhauser.com/wp-json/>; rel="https://api.w.org/" Link: <https://www.markdhauser.com/>; rel=shortlink X-Type: default Transfer-Encoding: chunked Connection: keep-alive X-Pass-Why: Set-Cookie: X-Mapping-fjhppofk=4D9C4096DE3B2E74FBEC7F51B8599593; path=/ |
WHOIS information |
---|
% IANA WHOIS server % for more information on IANA, visit http://www.iana.org % % Error: Invalid query |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1715 mistypes, associated with markdhauser.com:
If you are curious about what TLD extensions could also match the domain name of markdhauser.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: