Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Ye (blue) Boiiiiiiiiiiiii | Search engines recommend title length of around 50-60 characters. The length of this title is 25. |
Meta description | Just a blog dedicated to Crankgameplays! Welcome to the cranky crew! This blog is owned by the wonderful Lauren (she/her) and Em (he/they/she). Feel free to talk to us whenever you'd like! | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 188 characters. |
Load time | 0.3841 seconds on average | Website load speed is pretty fast. |
Total links on homepage | We found 48 links | This is a normal amount of links. |
Page HTML size | 17.7KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 66.6.32.21. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Server: openresty Date: Sat, 29 Jul 2017 11:04:17 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding P3P: CP="Tumblr's privacy policy is available here: https://www.tumblr.com/policy/en/privacy" X-XSS-Protection: 1; mode=block X-Content-Type-Options: nosniff X-Tumblr-User: friccfracccrankgameplaysthat X-UA-Compatible: IE=Edge,chrome=1 X-UA-Device: desktop Vary: X-UA-Device, Accept, Accept-Encoding |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 2100 mistypes, associated with friccfracccrankgameplaysthat.tumblr.com:
If you are curious about what TLD extensions could also match the domain name of friccfracccrankgameplaysthat.tumblr.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: