Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Deep Creek Lake Family Adventure Activities and Eco Tours - Kayaking Tours - Maryland Guided Hiking Trips - Team Building- Deep Creek Lake Activities for Kids | Search engines recommend title length of around 50-60 characters. The length of this title is 159. |
Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
Load time | 0.9261 seconds on average | Website load speed is pretty fast. |
Alexa global | 11 908 801, as last updated | According to Alexa, the website's popularity is not exactly high. Take this rank with a healthy pinch of salt. |
Quantcast global | 271 439 | The website's rank is quite poor. As with Alexa, QUANTCAST is not always perfectly representative of a website's performance. |
Total links on homepage | We found 91 links | This is a normal amount of links. |
Number of backlinks | Around 10 | Backlinks is one of the key metrics for search engines. This website seems to have a very low number of backlinks, which means poorer rank in search results. |
Page HTML size | 30.3KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 69.89.31.83. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
Parameter name | Status | Comment |
---|---|---|
Related websites | allearthecotours.com garretttrails.org deepcreekinns.com campearth.org cranesvillecountryrentals.com |
These are the websites that fall into the same category as deepcreeklakefamilyactivities.com, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
With over 4 million websites indexed (which can seem as a lot, or very little, depending on your point of view), Alexa is perhaps the oldest and certainly the best known ranking system, deservedly or not. The Alexa Global and Local ranks of a website are based on an approximate amount of visitors a given website receives. The more visitors, the higher the rank. The Alexa rank, be it Local or Global, should be taken with a pinch of salt. After all, visitor count is by far not the simple measure of a website's success it's made out to be. For example, a gardening website is never going to be as popular as a movie review website. It does not mean it's not popular within it's niche.
QUANTCAST - an advertising-related data processing company - mostly specializes in real-time audience analysis and measurements. In other words it, like Alexa, is basing its rankings on approximate traffic numbers. Currently, QUANTCAST has rated around 34 932 133 websites. Just like ALEXA, this is not a metric of huge importance, so don't base your SEO decisions on QUANTCAST rank, specifically. At best, it's a vague representation of how your website is doing in the grand scheme of things, but it does not take all that much context into account.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Server: nginx/1.12.1 Date: Sun, 19 Nov 2017 08:11:50 GMT Content-Type: text/html Content-Length: 30827 Connection: keep-alive Last-Modified: Tue, 14 Nov 2017 02:14:37 GMT Vary: Accept-Encoding X-Acc-Exp: 600 X-Proxy-Cache: EXPIRED deepcreeklakefamilyactivities.com Accept-Ranges: bytes |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 2196 mistypes, associated with deepcreeklakefamilyactivities.com:
If you are curious about what TLD extensions could also match the domain name of deepcreeklakefamilyactivities.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: