Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Deep Creek Lake Family Adventure Activities and Eco Tours - Kayaking Tours - Maryland Guided Hiking Trips - Team Building- Deep Creek Lake Activities for Kids | Search engines recommend title length of around 50-60 characters. The length of this title is 159. |
Meta description | Programs for youth and adults featuring nature tourism, eco kayak tours, guided wilderness hikes, and arts workshops for kids. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 126 characters. |
Load time | 1.0514 seconds on average | Website load speed is pretty fast. |
Total links on homepage | We found 124 links | This is a normal amount of links. |
Number of backlinks | Around 17 | Backlinks is one of the key metrics for search engines. This website seems to have a very low number of backlinks, which means poorer rank in search results. |
Page HTML size | 45.9KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 69.89.31.83. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
Parameter name | Status | Comment |
---|---|---|
Relevant categories | Science Environment Education Outdoor Programs |
The most obvious area of interest for the target audience are these categories. Most, if not all of them can be attributed to the website in question. |
Related websites | seeingmiracleseveryday.blogspot.com allearthecotours.com lisalyle.com deepcreeklakefamilyactivities.com sped2work.tripod.com |
These are the websites that fall into the same category as campearth.org, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Server: nginx/1.12.1 Date: Sun, 29 Oct 2017 17:53:22 GMT Content-Type: text/html Content-Length: 46905 Connection: keep-alive Last-Modified: Wed, 25 Oct 2017 14:52:49 GMT Vary: Accept-Encoding X-Acc-Exp: 600 X-Proxy-Cache: EXPIRED campearth.org Accept-Ranges: bytes |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1771 mistypes, associated with campearth.org:
If you are curious about what TLD extensions could also match the domain name of campearth.org well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: