Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Vehicle Tracking GPS System | Car Fleet Tracker | The Black Box | Search engines recommend title length of around 50-60 characters. The length of this title is 63. |
Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
Keywords | vehicle tracking system, gps system, vehicle tracking, car tracker, car gps tracker, bike tracker, fleet tracking, bike gps tracker, vehicle tracking software, vehicle tracker india, www.theblackbox.in, theblackbox.in, gps the black box, the black box gps system | We did not expect meta keywords to be used. It's a worrying sign more than anything, really, as websites with meta keywords often tend to be spammy. |
Load time | 0.5121 seconds on average | Website load speed is pretty fast. |
Alexa global | 977 109, as last updated | According to Alexa, the website's popularity is not exactly high. Take this rank with a healthy pinch of salt. |
Total links on homepage | We found 28 links | This is a normal amount of links. |
Number of backlinks | Around 1 | Backlinks is one of the key metrics for search engines. This website seems to have a very low number of backlinks, which means poorer rank in search results. |
Page HTML size | 12KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 160.153.71.168. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
Parameter name | Status | Comment |
---|---|---|
Related websites | trackmaster.in hitecpoint.in blackboxgps.com pumaguard.com gpsvehicletrackingsystemindia.wordpress.com |
These are the websites that fall into the same category as theblackbox.in, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
Absolute accuracy is accessible only by the webmasters. If you keep that in mind, perhaps you will find out approximate numbers of some use.
Where appropriate, we'll add an insight, but the numbers themselves speak clearly enough, eh?
Parameter name | Status | Comment |
---|---|---|
Time spent on site | 2:05 | This is a decent average time spent on a website. |
With over 4 million websites indexed (which can seem as a lot, or very little, depending on your point of view), Alexa is perhaps the oldest and certainly the best known ranking system, deservedly or not. The Alexa Global and Local ranks of a website are based on an approximate amount of visitors a given website receives. The more visitors, the higher the rank. The Alexa rank, be it Local or Global, should be taken with a pinch of salt. After all, visitor count is by far not the simple measure of a website's success it's made out to be. For example, a gardening website is never going to be as popular as a movie review website. It does not mean it's not popular within it's niche.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Date: Wed, 29 Nov 2017 22:56:50 GMT Server: Apache Last-Modified: Wed, 07 Sep 2016 16:31:46 GMT ETag: "b5c1f04-2fc9-53bed730b5a1c" Accept-Ranges: bytes Content-Length: 12233 Vary: Accept-Encoding,User-Agent Content-Type: text/html |
WHOIS information |
---|
Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy. Domain ID:D9196819-AFIN Domain Name:THEBLACKBOX.IN Created On:14-Feb-2015 12:29:03 UTC Last Updated On:26-Dec-2016 04:10:00 UTC Expiration Date:14-Feb-2019 12:29:03 UTC Sponsoring Registrar:GoDaddy.com, LLC (R101-AFIN) Status:CLIENT DELETE PROHIBITED Reason: Status:CLIENT RENEW PROHIBITED Reason: Status:CLIENT TRANSFER PROHIBITED Reason: Status:CLIENT UPDATE PROHIBITED Reason: Registrant ID:CR187818707 Registrant Name:The Black Box Registrant Organization:The Black Box Registrant Street1:GIDC Registrant Street2:Matar Registrant Street3: Registrant City:Kheda Registrant State/Province:Gujarat Registrant Postal Code:382000 Registrant Country:IN Registrant Phone:+91.9909911898 Registrant Phone Ext.: Registrant FAX: Registrant FAX Ext.: Registrant Email: Admin ID:CR187818709 Admin Name:The Black Box Admin Organization:The Black Box Admin Street1:GIDC Admin Street2:Matar Admin Street3: Admin City:Kheda Admin State/Province:Gujarat Admin Postal Code:382000 Admin Country:IN Admin Phone:+91.9909911898 Admin Phone Ext.: Admin FAX: Admin FAX Ext.: Admin Email: Tech ID:CR187818708 Tech Name:The Black Box Tech Organization:The Black Box Tech Street1:GIDC Tech Street2:Matar Tech Street3: Tech City:Kheda Tech State/Province:Gujarat Tech Postal Code:382000 Tech Country:IN Tech Phone:+91.9909911898 Tech Phone Ext.: Tech FAX: Tech FAX Ext.: Tech Email: Name Server:NS29.DOMAINCONTROL.COM Name Server:NS30.DOMAINCONTROL.COM Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: Name Server: DNSSEC:Unsigned |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1736 mistypes, associated with theblackbox.in:
If you are curious about what TLD extensions could also match the domain name of theblackbox.in well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: