Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Primary Care Walk-in Medical Clinic - Home | Search engines recommend title length of around 50-60 characters. The length of this title is 42. |
Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
Keywords | primary, care, walk in, medical, clinic, urgent care, fountain hills, DOT physicals, sports physical, pap smears, family medicine, family practice, internal medicine, fountain hills medical clinic,scottsdale | We did not expect meta keywords to be used. It's a worrying sign more than anything, really, as websites with meta keywords often tend to be spammy. |
Load time | 0.452 seconds on average | Website load speed is pretty fast. |
Total links on homepage | We found 6 links | Honestly, this is a strange amount of links for a homepage. |
Page HTML size | 18.9KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
Website server | Server appears to be online. The IP address for the server is 66.96.149.1. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
Parameter name | Status | Comment |
---|---|---|
Related websites | fountainhillsfamilypractice.com fountainhillsdoctors.com mdsfamilypractice.com primarywalkinmedical.com vineyardmedicalcare.com |
These are the websites that fall into the same category as primarycarewalkinmedicalclinic.com, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Date: Sat, 11 Nov 2017 18:40:02 GMT Content-Type: text/html; charset=utf-8 Content-Length: 19356 Connection: keep-alive Server: Apache/2 Set-Cookie: is_mobile=0; path=/; domain=primarycarewalkinmedicalclinic.com Last-Modified: Tue, 09 May 2017 15:08:54 GMT ETag: "4b9c-54f18bbf7f783" Accept-Ranges: bytes Cache-Control: max-age=3600 Expires: Sat, 11 Nov 2017 19:40:02 GMT Age: 0 |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 2104 mistypes, associated with primarycarewalkinmedicalclinic.com:
If you are curious about what TLD extensions could also match the domain name of primarycarewalkinmedicalclinic.com well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: