Here is an overview of what we consider to be the key website statistics and information:
Parameter name | Status | Comment |
---|---|---|
Website meta title | Home | Parravans Caravan World | Windsor | 02 4577 5577 | Search engines recommend title length of around 50-60 characters. The length of this title is 55. |
Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
Keywords | Parravans Caravan World, Used Caravans, River Caravan, Goldstream Caravan, Atlantic Caravan, Deeson Caravan, Deeson Caravan, Caravan Hire, Finance, Insurance, Servicing, Repairs, Caravan Parts, Windsor, New South Wales | We did not expect meta keywords to be used. It's a worrying sign more than anything, really, as websites with meta keywords often tend to be spammy. |
Load time | 3.8197 seconds on average | Load speed is a concern and should be improved if and when possible. |
Alexa global | 10 977 451, as last updated | According to Alexa, the website's popularity is not exactly high. Take this rank with a healthy pinch of salt. |
Total links on homepage | We found 37 links | This is a normal amount of links. |
Number of backlinks | Around 11 | Backlinks is one of the key metrics for search engines. This website seems to have a very low number of backlinks, which means poorer rank in search results. |
Page HTML size | 60.7KB | How do we put this... improvement is quite necessary. Load speed is a very important factor in so many ways! |
Website server | Server appears to be online. The IP address for the server is 52.221.45.247. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
Parameter name | Status | Comment |
---|---|---|
Related websites | parravansnewcastle.com.au regentcaravans.com.au fivestarcaravans.com.au hek.com.au getawaycaravanandcampinghire.com.au |
These are the websites that fall into the same category as parravans.com.au, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
With over 4 million websites indexed (which can seem as a lot, or very little, depending on your point of view), Alexa is perhaps the oldest and certainly the best known ranking system, deservedly or not. The Alexa Global and Local ranks of a website are based on an approximate amount of visitors a given website receives. The more visitors, the higher the rank. The Alexa rank, be it Local or Global, should be taken with a pinch of salt. After all, visitor count is by far not the simple measure of a website's success it's made out to be. For example, a gardening website is never going to be as popular as a movie review website. It does not mean it's not popular within it's niche.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
Header in detail |
---|
HTTP/1.1 200 OK Cache-Control: private Content-Type: text/html; charset=utf-8 Server: Microsoft-IIS/7.5 X-Umbraco-Version: 4.7 X-Umbraco-Version: 4.7 X-Umbraco-Version: 4.7 X-Umbraco-Version: 4.7 X-Umbraco-Version: 4.7 X-Umbraco-Version: 4.7 X-Umbraco-Version: 4.7 X-Umbraco-Version: 4.7 X-AspNet-Version: 4.0.30319 X-Powered-By: Unique Websites www.uniquewebsites.com.au X-UA-Compatible: IE=Edge Date: Mon, 30 Oct 2017 05:27:11 GMT Content-Length: 61885 |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1710 mistypes, associated with parravans.com.au:
If you are curious about what TLD extensions could also match the domain name of parravans.com.au well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: