Here is an overview of what we consider to be the key website statistics and information:
| Parameter name | Status | Comment |
|---|---|---|
| Website meta title | Default Parallels Plesk Panel Page | Search engines recommend title length of around 50-60 characters. The length of this title is 34. |
| Meta description | A description has not been provided for this site. | To make sure all the meta description is visible in search results page, Google recommends length of up to 320 characters at the most. This description has exactly 50 characters. |
| Load time | 0.0521 seconds on average | Website load speed is pretty fast. |
| Alexa global | 757 572, as last updated | According to Alexa, the website's popularity is not exactly high. Take this rank with a healthy pinch of salt. |
| Total links on homepage | We found 20 links | This is a normal amount of links. |
| Number of backlinks | Around 514 | Such a decent amount of backlinks certainly ads to the ranking. |
| Page HTML size | 9.1KB | Load speed (and overall responsiveness) is such an important factor for both search engines and user experience, would you not agree? With that in mind, this is a very good result. |
| Website server | Server appears to be online. The IP address for the server is 176.31.226.210. | It's unfortunate, but despite our best attempts, we failed to gather enough data to provide a meaningful insight at this time. |
What, all that information was not enough? You want... more? Right, then. You asked for it.
As we've mentioned before, traffic is not a key metric. However, the target audience does say a lot about what's been done to optimize the website, as well as what should be done going forwards. Let's see if we have any useful information here.
| Parameter name | Status | Comment |
|---|---|---|
| Related websites | entrelane.com booyahcraft.com codingpiratesgame.com bufsoftware.com downloadgracevanderwaalperfectlyimperfect.wordpress.com |
These are the websites that fall into the same category as mafia2.fr, and so target the same audience and, likely, keywords. To a larger or smaller extent, all of them are competitors. |
With over 4 million websites indexed (which can seem as a lot, or very little, depending on your point of view), Alexa is perhaps the oldest and certainly the best known ranking system, deservedly or not. The Alexa Global and Local ranks of a website are based on an approximate amount of visitors a given website receives. The more visitors, the higher the rank. The Alexa rank, be it Local or Global, should be taken with a pinch of salt. After all, visitor count is by far not the simple measure of a website's success it's made out to be. For example, a gardening website is never going to be as popular as a movie review website. It does not mean it's not popular within it's niche.
Similarly to how a hard drive or a modern SSD device holds your files, a server holds all the files the website needs to operate. To load a webpage, your browser needs to contact the said server and request files - strings of code that make up the website into what it is, including images, text and database entries. Each physical server has a unique IP address that is used by the browser to contact it.
Let's see what technical information we've managed to gather:
| Header in detail |
|---|
HTTP/1.1 200 OK Date: Mon, 05 Jun 2017 04:31:35 GMT Server: Apache Last-Modified: Sun, 11 Aug 2013 15:18:52 GMT ETag: "5040c8b-2488-4e3ad8687df33" Accept-Ranges: bytes Content-Length: 9352 Vary: Accept-Encoding X-Powered-By: PleskLin Content-Type: text/html |
| WHOIS information |
|---|
domain: mafia2.fr status: ACTIVE hold: NO holder-c: ANO00-FRNIC admin-c: ANO00-FRNIC tech-c: HU3-FRNIC zone-c: NFC1-FRNIC nsl-id: NSL46087-FRNIC registrar: 1&1 Internet SE Expiry Date: 22/08/2017 created: 22/08/2007 last-update: 22/08/2016 source: FRNIC ns-list: NSL46087-FRNIC nserver: 91-121-51-224.ovh.net nserver: 46-105-51-163.ovh.net source: FRNIC registrar: 1&1 Internet SE type: Isp Option 1 address: Ernst-Frey Strasse 9 address: 76135 KARLSRUHE country: DE phone: +49 721 91374 50 fax-no: +49 721 91374 215 e-mail: website: http://registrar.1and1.info anonymous: NO registered: 17/01/2001 source: FRNIC nic-hdl: ANO00-FRNIC type: PERSON contact: Ano Nymous remarks: -------------- WARNING -------------- remarks: While the registrar knows him/her, remarks: this person chose to restrict access remarks: to his/her personal data. So PLEASE, remarks: don't send emails to Ano Nymous. This remarks: address is bogus and there is no hope remarks: of a reply. remarks: -------------- WARNING -------------- registrar: 1&1 Internet SE changed: 09/08/2006 anonymous@anonymous anonymous: YES obsoleted: NO eligstatus: ok eligdate: 09/08/2006 00:00:00 source: FRNIC nic-hdl: HU3-FRNIC type: ROLE contact: Hostmaster UNETUN address: 1&1 Internet Sarl. address: 7, place de la Gare address: 57200 Sarreguemines country: FR e-mail: admin-c: IR2-FRNIC tech-c: IR2-FRNIC registrar: 1&1 Internet SE changed: 15/03/2004 anonymous: NO obsoleted: NO source: FRNIC |
A good domain address is usually one that is easy to spell, resulting in the smallest amount of mistypes possible. Still, such a thing inevitably happens. Here is a list with the most frequent 1710 mistypes, associated with mafia2.fr:
If you are curious about what TLD extensions could also match the domain name of mafia2.fr well, we have prepared an extensive list for you to look through:
We are glad you have finished this report. Hopefully, you found what you were looking for. In case you need more information to compare, here is a list of some other detailed overviews we have prepared: